MUC24_MOUSE Q9R0L9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0L9
Recommended name：Sialomucin core protein 24
EC number：
Alternative names：(MUC-24) (Endolyn) (Multi-glycosylated core protein 24) (MGC-24) (MGC-24v) (CD antigen CD164)
Cleaved into：
GeneID：53599
Gene names (primary )：Cd164
Gene names (synonym )：
Gene names (ORF )：
Length：197
Mass：21059
Sequence：MSGSSRRLLWAATCLAVLCVSAAQPNITTLAPNVTEVPTTTTKVVPTTQMPTVLPETCASFNSCVSCVNATFTNNITCFWLHCQEANKTYCANEPLSNCSQVNRTDLCSVIPPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGTTNTTLTPTSQPERKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL
Tissue specificity：Expressed at high levels in the submaxillary gland and kidney, at moderate levels in the brain, heart, lung, liver, intestine, testis, muscle and bone marrow, and at low levels in the pancreas, spleen and thymus. In the ear, expressed in the inner and outer hair cells of the organ of Corti, cells of Kolliker's organ, cells in the lateral cochlear wall behind the spiral prominence and cells of the stria vascularis (PubMed:26197441). {ECO:0000269|PubMed:10491205, ECO:0000269|PubMed:11027692, ECO:0000269|PubMed:26197441}.
Induction：
Developmental stage：During embryogenesis, expression in found in all stages examined, with the highest levels of expression at early stages (8.5 dpc) and moderate levels of expression being found at mid- to late stages of embryogenesis. Expressed during early stages of skeletal muscle development. At embryonic stages 9.5 dpc and 10.5 dpc, expressed strongly in the dorsal somite (the structure of origin for skeletal muscle precursors). It is also expressed at later stages of muscle development;. {ECO:0000269|PubMed:10491205, ECO:0000269|PubMed:18227060}.
Protein families：CD164 family