LAPM5_MOUSE Q61168
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61168
Recommended name：Lysosomal-associated transmembrane protein 5
EC number：
Alternative names：(Lysosomal-associated multitransmembrane protein 5) (Retinoic acid-inducible E3 protein)
Cleaved into：
GeneID：16792
Gene names (primary )：Laptm5
Gene names (synonym )：
Gene names (ORF )：
Length：261
Mass：29602
Sequence：MASRAAPVRQTCCCFNIRVATIALAIYHIVMSVLLFIEHVVEVARGKVSCRFFKMPYLRMADLLSSFLLIGVLFIISISLLFGVVKNREKYLIPFLSLQIMDFLLCLLTLLGSYIELPAYLKLARPRPGPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEGVPHSQFINMMLIFSVAFITVLILKVYMFKCVYTCYKFLKHMNSAMEDSSSKMFLKVALPSYEEALSLPPKTPEGDPAPPPYSEV
Tissue specificity：Preferentially expressed in adult hematopoietic tissues. High levels in lymphoid and myeloid tissues. {ECO:0000269|PubMed:8661146}.
Induction：By retinoic acid. Likely target of the activated retinoic acid receptor alpha.
Developmental stage：During embryonic development it is expressed in both hematopoietic and nonhematopoietic tissues.
Protein families：LAPTM4/LAPTM5 transporter family