ATF4_MOUSE Q06507
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06507
Recommended name：Cyclic AMP-dependent transcription factor ATF-4
EC number：
Alternative names：(cAMP-dependent transcription factor ATF-4) (Activating transcription factor 4) (C/EBP-related ATF) (C/ATF) (Cyclic AMP-responsive element-binding protein 2) (CREB-2) (cAMP-responsive element-binding protein 2)
Cleaved into：
GeneID：11911
Gene names (primary )：Atf4
Gene names (synonym )：Creb2
Gene names (ORF )：
Length：349
Mass：38355
Sequence：MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
Tissue specificity：Ubiquitously expressed in adults. {ECO:0000305|PubMed:10885750}.
Induction：Specifically produced in response to various stress, such as endoplasmic reticulum (ER) stress, amino acid starvation, or oxidative stress (PubMed:21159964, PubMed:11106749, PubMed:12667446, PubMed:15277680). In absence of stress, some upstream open reading frame (uORF) of this transcript is translated, thereby preventing its translation (PubMed:11106749, PubMed:15277680). In response to stress and subsequent eIF-2-alpha/EIF2S1 phosphorylation, preferentially translated (PubMed:15277680). Expressed in a circadian manner in the liver with an increased expression seen during the light phase (PubMed:21768648, PubMed:22572884). Expressed in a circadian manner in the midbrain with an increased expression seen during the dark phase (at protein level) (PubMed:21768648, PubMed:22572884). Expressed in a circadian manner also in the suprachiasmatic nucleus (SCN) of the brain, cerebral cortex, kidney and small intestine (PubMed:21768648, PubMed:22572884). {ECO:0000269|PubMed:11106749, ECO:0000269|PubMed:12667446, ECO:0000269|PubMed:15277680, ECO:0000269|PubMed:21159964, ECO:0000269|PubMed:21768648, ECO:0000269|PubMed:22572884}.
Developmental stage：During embryonic development, expressed at high levels in anterior epithelial lens cells at E14.5 (PubMed:10885750). At 16.5 dpc, expressed in osteoblasts surrounding newly formed trabecular bone (PubMed:19232401). At postnatal day 2, detected in most osteoblasts and lining cells (PubMed:19232401). By postnatal week 4, is detected in fewer osteoblasts, but remains present in lining cells (at protein level) (PubMed:19232401). {ECO:0000269|PubMed:10885750, ECO:0000269|PubMed:19232401}.
Protein families：BZIP family