K1C16_MOUSE Q9Z2K1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z2K1
Recommended name：Keratin, type I cytoskeletal 16
EC number：
Alternative names：(Cytokeratin-16) (CK-16) (Keratin-16) (K16)
Cleaved into：
GeneID：16666
Gene names (primary )：Krt16
Gene names (synonym )：Krt1-16
Gene names (ORF )：
Length：469
Mass：51606
Sequence：MATCSRQFTSSSSMKGSCGIGGGSSRMSSILAGGSCRAPSTCGGMSVTSSRFSSGGVCGIGGGYGGSFSSSSFGGGLGSGFGGRFDGFGGGFGAGLGGGLGGGIGDGLLVGSEKVTMQNLNDRLATYLDKVRALEEANRDLEVKIRDWYQRQRPTEIKDYSPYFKTIEDLKSKIIIATQENAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGLRKVLDELTLSRADLEMQIENLREELAFLKKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKNRRDVEAWFLRKTEELNKEVASNSDLIQSNRSEVAELRRVFQGLEIELQSQLSMKASLENSLEETKGRYCMQLSQIQGLISSVEEQLAQLRCEMEQQSQEYNILLDVKTRLEQEIATYRRLLDGENIHSSSQHSSGQSYSSREVFSSSSRQPRSILKEQGSTSFSQSQSQSSRD
Tissue specificity：Expressed in the epithelia of the tongue, upper and lower palate, footpad, proximal nail fold and nail bed, penile spine, sweat gland ducts, and back epidermis (at protein level) (PubMed:12445204). Expressed in upper suprabasal layers of the corneal epithelium (at protein level) (PubMed:26758872). Expressed in internal stratified epithelia in the esophagus and vagina (at protein level) (PubMed:12445204). Expressed in transitional stratified squamous epithelia in the forestomach, anal canal, and nasal cavity (at protein level) (PubMed:12445204). Expressed in transitional epithelia of the ureter, bladder and urethra (at protein level) (PubMed:12445204). In mature hair follicles, expressed in the companion layer of the outer root sheath during anagen and in the club hair sheath during catagen and telogen (at protein level) (PubMed:12445204). {ECO:0000269|PubMed:12445204, ECO:0000269|PubMed:26758872}.
Induction：In response to epidermal stress such as wounding. {ECO:0000269|PubMed:8636216}.
Developmental stage：During embryonic development, initially localizes within early hair germs, but rapidly shifts to a subset of cells at the interface of basal and suprabasal cells above and around the hair germ. {ECO:0000269|PubMed:12445204}.
Protein families：Intermediate filament family