DOK2_MOUSE   O70469


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70469

Recommended name:Docking protein 2

EC number:

Alternative names:(Dok-related protein) (Dok-R) (Downstream of tyrosine kinase 2) (IL-four receptor-interacting protein) (FRIP) (p56(dok-2))

Cleaved into:

GeneID:13449

Gene names  (primary ):Dok2

Gene names  (synonym ):Frip

Gene names  (ORF ):

Length:412

Mass:45522

Sequence:MVRMEEPAVKQGFLHLQQQQTFGKKWRRFAAVLYGESGCALARLELQDVPEKTRRGEATRKVVRLSDCLRVAEVGSEASSPRDTSAFILETKERLYLLAAPSAERSDWIQAICLLAFPGQRKGSPGLEEKSGSPCMEENELYSSSTTGLCKEYMVTIRPTEASERCRLRGSYTLRTGVSALELWGGPEPGTQLYDWPYRFLRRFGRDKATFSFEAGRRCLSGEGNFEFETRHGNEIFQALEKVIAVQKNATPSGPPSLPATGPMMPTVLPRPESPYSRPHDSLPSPSPGTLVPGMRPGAPEGEYAVPFDTVAHSLRKSFRGLLTGPPPHLPDPLYDSIQEDPGAPLPDHIYDEPEGVAALSLYDRTQRPSGETWREQATADGGPSSLQQDSSVPDWPQATEYDNVILKKGPK

Tissue specificity:Highly expressed in spleen and lung. {ECO:0000269|PubMed:11470823, ECO:0000269|PubMed:9478921}.

Induction:

Developmental stage:During embryonic liver development, expressed in the islands of cells, consistent with an expression in hematopoietic precursors. {ECO:0000269|PubMed:11470823}.

Protein families:DOK family, Type A subfamily


   💬 WhatsApp