SFRP2_MOUSE   P97299


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97299

Recommended name:Secreted frizzled-related protein 2

EC number:

Alternative names:(sFRP-2) (Protein SDF5) (Secreted apoptosis-related protein 1) (SARP-1)

Cleaved into:

GeneID:20319

Gene names  (primary ):Sfrp2

Gene names  (synonym ):Sarp1 Sdf5

Gene names  (ORF ):

Length:295

Mass:33469

Sequence:MPRGPASLLLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC

Tissue specificity:Highly expressed in the eye. Weaker expression in heart and lung. {ECO:0000269|PubMed:9096311}.

Induction:

Developmental stage:During kidney development, expressed at 10.5 dpc in the mesonephric tubules, and at 12.5 dpc strongly expressed in the comma shaped bodies and surrounding ureter stalk. In 14.5 dpc kidney, expressed in the S-shaped bodies. In the developing nervous system, expressed in the presumptive hindbrain and the ventral part of the neural tube from 8.0 dpc onwards. At 9.5 dpc, expression is additionally detected in the mesonephros and the optic vesicle. 10 dpc expression is found in the second and third branchial cleft, in the eye, the ventral neural tube and specific rhombomeres and prosomers. 10.5 dpc brain shows specific expression in the basal and alar plate. In developing eye, expressed at 9.0 dpc in the optic placode, and at 9.5 dpc in the optic vesicle. By 10.5 dpc, expression found in the lens vesicle and the inner layer of the invaginating optic vesicle. Strong expression at 14.5 dpc in the anterior lens epithelium, decreasing thereafter. Expression also found in the prospective neural retina. In developing limbs, expression found at 11.5 dpc in the shoulder and at the distal end of the cartilaginous condensation. At 12.5 dpc, expressed in the foot and hand paddle extending along the digital rays. Expressed, at 13.5 dpc and 14.5 dpc, in the forelimb and hindlimb where the interphalangeal joints will develop. Also expressed at 14.5 dpc between the sternal bands and where the ribs contact the sternum. In other developing structures, expression found at 11.5 dpc, in the maxillary and mandibular component of the first branchial arch, and later, in the loose mesenchyme surrounding cartilage and epithelia of the skull as well as in the whisker follicles. Also expressed in developing teeth, with the highest levels at 15.5 dpc and 16.5 dpc in the mesenchyme and the dental epithelium of the developing molars. Expressed in development smooth muscle surrounding the esophagus at 11.5 dpc, the dorsal aorta and the ductus arteriosus at 14.5 dpc, and the ureter stalk at 15.5 dpc. {ECO:0000269|PubMed:15226823, ECO:0000269|PubMed:9739103}.

Protein families:Secreted frizzled-related protein (sFRP) family


   💬 WhatsApp