RSPH1_MOUSE Q8VIG3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VIG3
Recommended name：Radial spoke head 1 homolog
EC number：
Alternative names：(Male meiotic metaphase chromosome-associated acidic protein) (Meichroacidin) (Testis-specific gene A2 protein)
Cleaved into：
GeneID：22092
Gene names (primary )：Rsph1
Gene names (synonym )：Tsga2
Gene names (ORF )：
Length：301
Mass：34181
Sequence：MSDLGSEELEEEGENDLGEYEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFMNKNPVGPGKYVFDIGCEQHGEYRLTDTERGEEEEEEETLVNIVPKWKALNITELALWTPTLSEEQPPPEGQGQEEPQGLTGVGDPSEDIQAEGFEGELEPRGADEDVDTFRQESQENSYDIDQGNLNFDEEPSDLQD
Tissue specificity：Expressed in the trachea, ependymal cells and oviduct (at protein level) (PubMed:32203505). Germ cell specific. Specifically expressed in testis, and to a lower extent in ovary. Not expressed in somatic tissues (PubMed:9578619). {ECO:0000269|PubMed:32203505, ECO:0000269|PubMed:9578619}.
Induction：
Developmental stage：During male germ cell development it is not detected until 12 days. Significant expression is detected from 14-day-old through to adult testis. Expression is first detected in the pachytene spermatocytes at stage V, becomes stronger from the late pachytene spermatocytes to round spermatid stage, and then gradually decreases as the morphogenesis proceeds further. Not expressed in germ cells located in the first layer of the seminiferous epithelium (spermatogonia, leptotene and zygotene spermatocytes). {ECO:0000269|PubMed:9578619}.
Protein families：