PXT1_MOUSE Q8K459
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K459
Recommended name：Peroxisomal testis-specific protein 1
EC number：
Alternative names：(Small testis-specific peroxisomal protein)
Cleaved into：
GeneID：69307
Gene names (primary )：Pxt1
Gene names (synonym )：Stepp
Gene names (ORF )：
Length：51
Mass：5934
Sequence：MQLRHIGDSVNHRVIQEHLAQEVGDVLAPFVALVFVRGQVLLRFFWNNHLL
Tissue specificity：Testis-specific. {ECO:0000269|PubMed:18160785}.
Induction：
Developmental stage：During spermatogenesis, it is first detected in testis at 15 days postpartum (dpp). Expressed at higher level at 17 dpp, 20 dpp, 25 dpp and in adult testis. First expressed when primary spermatocytes are present in postnatal mouse testis. {ECO:0000269|PubMed:18160785}.
Protein families：