HES7_MOUSE Q8BKT2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BKT2
Recommended name：Transcription factor HES-7
EC number：
Alternative names：(mHes7) (Hairy and enhancer of split 7) (bHLH factor Hes7)
Cleaved into：
GeneID：84653
Gene names (primary )：Hes7
Gene names (synonym )：
Gene names (ORF )：
Length：225
Mass：24890
Sequence：MVTRERAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVEPPGVPRSPGQDAEALASCYLSGFRECLLRLAAFAHDASPAARSQLFSALHGYRRPKPPRPEAVDPGLPAPRPPLDPASPILGPALHQRPPVHQGPPSPRLAWSPSHCSSRAGDSGAPAPLTGLLPPPPPPYRQDGAPKAPSLPPPAFWRPWP
Tissue specificity：
Induction：By Notch-signaling. {ECO:0000269|PubMed:11260262}.
Developmental stage：Dynamic expression in the presomitic mesoderm (PSM). At 8.5 dpc, expressed in two bilateral domains: rostral and caudal stripes. The rostral bands are located posterior to the newly formed somite, while the caudal bands extend to the most caudal tip. During 9.0 dpc-12.0 dpc stages, again specifically expressed in two domains of the PSM. {ECO:0000269|PubMed:11260262, ECO:0000269|PubMed:15170214}.
Protein families：