3BHS6_MOUSE O35469
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35469
Recommended name：3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6
EC number：EC 1.1.1.-
Alternative names：(3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type VI) (3-beta-HSD VI) [Includes: 3-beta-hydroxy-Delta(5)-steroid dehydrogenase (3-beta-hydroxy-5-ene steroid dehydrogenase) (Progesterone reductase); Steroid Delta-isomerase (Delta-5-3-ketosteroid isomerase)]
Cleaved into：
GeneID：15497
Gene names (primary )：Hsd3b6
Gene names (synonym )：
Gene names (ORF )：
Length：373
Mass：41977
Sequence：MPGWSCLVTGAGGFLGQRIVQLLMQEKDLEEIRVLDKFFRPETREQFFNLDTNIKVTVLEGDILDTQYLRKACQGISVVIHTAAVIDVTGVIPRQTILDVNLKGTQNLLEACIQASVPAFIFSSSVDVAGPNSYKEIILNGNEEEHHESIWSDPYPYSKKMAEKAVLAANGSMLKIGGTLHTCALRPMYIYGERSPFISNTIITALKNKNILGCTGKFSTANPVYVGNVAWAHILAARGLRDPKKSPNIQGEFYYISDDTPHQSYDDLNYTLSKEWGFCPDSSWSLPVPLLYWLAFMLETVSFLLSPIYRFIPPFNRHLVTLTGSTFTFSYKKAQRDLGYEPLVSWEEAKQKTSEWIGTLVEQHRETLDTKSQ
Tissue specificity：Expressed in skin and testis.
Induction：
Developmental stage：Earliest isoform to be expressed during embryogenesis in cells of embryonic origin at 7 and 9.5 dpc, and is the major isoform expressed in uterine tissue at the time of implantation (4.5 dpc) and continues to be expressed in uterine tissue at 6.5, 7.5 and 9.5 dpc. It is expressed in giant trophoblasts at 9.5 dpc and is expressed in the placenta through 15.5 dpc.
Protein families：3-beta-HSD family