OTX2_MOUSE P80206
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P80206
Recommended name：Homeobox protein OTX2
EC number：
Alternative names：(Orthodenticle homolog 2)
Cleaved into：
GeneID：
Gene names (primary )：Otx2
Gene names (synonym )：Otx-2
Gene names (ORF )：
Length：289
Mass：31622
Sequence：MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL
Tissue specificity：Brain: restricted regions of the developing rostral brain including the presumptive cerebral cortex and olfactory bulbs; expressed in the developing olfactory, auricolar and ocular systems, including the covering of the optic nerve.
Induction：
Developmental stage：Embryo.
Protein families：Paired homeobox family, Bicoid subfamily