NOGG_MOUSE P97466
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97466
Recommended name：Noggin
EC number：
Alternative names：
Cleaved into：
GeneID：18121
Gene names (primary )：Nog
Gene names (synonym )：
Gene names (ORF )：
Length：232
Mass：25770
Sequence：MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Tissue specificity：Expressed in condensing cartilage and immature chondrocytes. {ECO:0000269|PubMed:9603738}.
Induction：
Developmental stage：Embryonic expression was first detected in the node at 7.5 dpc. By early somite stages, expression extends anteriorly along the entire length of the notochord and is expressed in the dorsal neural tube from the caudal hindbrain to the posterior-most region of the embryo. By the time cranial tube closure is completed expression is continuous along most of the dorsal midline of the neural tube, to its rostral termination at the base of the forebrain. Expression in the neural tube and caudal notochord remains unchanged during early organogenesis from 9.5 dpc to 10.5 dpc. {ECO:0000269|PubMed:9585504}.
Protein families：Noggin family