PA2GE_MOUSE Q9QUL3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QUL3
Recommended name：Group IIE secretory phospholipase A2
EC number：EC 3.1.1.4
Alternative names：(GIIE sPLA2) (sPLA2-IIE) (Phosphatidylcholine 2-acylhydrolase 2E)
Cleaved into：
GeneID：26970
Gene names (primary )：Pla2g2e
Gene names (synonym )：
Gene names (ORF )：
Length：142
Mass：15943
Sequence：MKPPIALACLCLLVPLAGGNLVQFGVMIERMTGKPALQYNDYGCYCGVGGSHWPVDETDWCCHAHDCCYGRLEKLGCDPKLEKYLFSITRDNIFCAGRTACQRHTCECDKRAALCFRHNLNTYNRKYAHYPNKLCTGPTPPC
Tissue specificity：Highly expressed in skin and uterus, and at lower levels in various other tissues (PubMed:27226633, PubMed:10531313, PubMed:10681567, PubMed:11922621). Expressed in hair follicles, specifically localized in companion cells of the outer root sheath and cuticular cells of the inner root sheath in hair follicles during anagen (PubMed:27226633). Expressed in white and brown adipose tisue (PubMed:24910243). {ECO:0000269|PubMed:10531313, ECO:0000269|PubMed:10681567, ECO:0000269|PubMed:11922621, ECO:0000269|PubMed:24910243, ECO:0000269|PubMed:27226633}.
Induction：Up-regulated in thymus, small intestine, brain, heart, testis, kidney and lung upon endotoxin challenge (PubMed:10681567, PubMed:11922621). Detected in alveolar macrophage-like cells upon endotoxin challenge (PubMed:10681567). Up-regulated in white and brown adipocytes upon high-fat diet (PubMed:24910243). Up-regulated in ear epidermis in response to topical dermatitis agent 2,4-dinitrobenzene (DNFB) (PubMed:11922621). {ECO:0000269|PubMed:10681567, ECO:0000269|PubMed:11922621, ECO:0000269|PubMed:24910243}.
Developmental stage：Expressed abundantly in hair follicles during the anagen phase. Low expression is observed before birth, then follows hair cycle progression: up-regulated markedly during P5-P15 (anagen phase), declining to nearly the basal level during P20-P25 (catagen and telogen) and then increasing again at P30 (next anagen). {ECO:0000269|PubMed:27226633}.
Protein families：Phospholipase A2 family