TAFA2_MOUSE Q7TPG7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TPG7
Recommended name：Chemokine-like protein TAFA-2
EC number：
Alternative names：
Cleaved into：
GeneID：268354
Gene names (primary )：Tafa2
Gene names (synonym )：Fam19a2
Gene names (ORF )：
Length：131
Mass：14647
Sequence：MNKRYLQKATQGKLLIIIFIVTLWGKAVSSANHHKAHHVRTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH
Tissue specificity：Mainly expressed in different brain regions, including cortex, amygdala and hippocampus (at protein level) (PubMed:30137205). Expressed by neurons and astrocytes (PubMed:30137205). {ECO:0000269|PubMed:30137205}.
Induction：
Developmental stage：Expressed as early as 13.5 dpc, increases and peaks at 2 weeks after birth and is highly expressed until adulthood. {ECO:0000269|PubMed:30137205}.
Protein families：TAFA family