S39A5_MOUSE Q9D856
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D856
Recommended name：Zinc transporter ZIP5
EC number：
Alternative names：(Solute carrier family 39 member 5) (Zrt- and Irt-like protein 5) (ZIP-5)
Cleaved into：
GeneID：72002
Gene names (primary )：Slc39a5
Gene names (synonym )：Zip5
Gene names (ORF )：
Length：535
Mass：56275
Sequence：MGPPVHHLLTGLCVGVALGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGHHEPPTGRAAPTSGDNFTHRLQEPELSVDIWAGMPLGPSGWGDQEESKAPDLHGSGPSSLDLFQRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPVAPLTPRQFALLCPALLYQIDSRVCIKTPAPAPPGDVLSALLHSGLAVLFLSLPAPLSLLLLRLLGPRLLRPVLGFLGALAVGTLCGDALLHLLPHAQGGRHTGPSEQSEEDLGPGLSVLGGLFLLFMLENTLGLVRHRGLRPRCCRNKRDLGEPNPDPEDGSGMVLRPLQAASEPEVQGQRENRQSSPSLAPPGHQGHSHEHRGGSIAWMVLLGDCLHNLTDGLALGAAFSDGFSSGLSTTLAVFCHELPHELGDFAMLLQEGLSFRKLLLLSLVSGALGLGGAALGVGLSLGPVPLTPWVFGTTAGVFLYVALVDMLPTLLRPPEPLPVFHVLLQGLGLLLGGSLMFTIALLEEQLVPTVPDG
Tissue specificity：Expressed in all stages of eye development and primarily in the sclera and several layers of the retina, including the inner segment, outer plexiform layer and ganglion cell layer. {ECO:0000269|PubMed:24891338}.
Induction：
Developmental stage：Expressed at 10 dpc, postnatal day P0, P13 and adult. {ECO:0000269|PubMed:24891338}.
Protein families：ZIP transporter (TC 2.A.5) family