Z354B_MOUSE Q9QXT9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXT9
Recommended name：Zinc finger protein 354B
EC number：
Alternative names：(Kidney, ischemia, and developmentally-regulated protein 2)
Cleaved into：
GeneID：27274
Gene names (primary )：Znf354b
Gene names (synonym )：Kid2 Zfp354b
Gene names (ORF )：
Length：601
Mass：68664
Sequence：MAPEQREGKSQVSVTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLGFPFTKPKMISVLQQGEEPWKSEKESHGCSPLGCHGSLQTTKSTQTKESLFQELKRKQLKRDEAWDFTSGKSCRPDNSFRTQDTNESLEIISINHTKILTIDKSRKNFKFGPSVGLKSIGKQKIAGEKTQRNSLEENSTLLSQPKLKTVEKRYKCSTCEKAFIHNSSLRKHLKNHTGERLFQCKDCLKAFSQSSALIQHQRTHTGEKPYICKECGKAFSHSASLCKHLRTHTLEKSYTCKECGKSFSRRSGLFLHQKIHARENPHKYNPGRKASTSLSGCQRIHSRKKTYLCNECGNTFKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCSECGKGFTSISRLNRHRIIHTGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNECGKTFRCNSSLSNHQRTHTGEKPYRCQECGMSFGQSAALIQHRRIHTGEKPFKCNTCGKSFRQSSSLIAHQRIHTGEKPYECSACGKLFSQRSSLTNHYRIHIEEDALNIDLHE
Tissue specificity：Expressed in brain and kidney. Lower levels in lung, muscle, heart, testis, tongue and eye. {ECO:0000269|PubMed:10564808}.
Induction：
Developmental stage：Expressed at 16.5 dpc in brain, heart, lung, kidney and gut. {ECO:0000269|PubMed:10564808}.
Protein families：Krueppel C2H2-type zinc-finger protein family