ZBT7A_MOUSE O88939
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88939
Recommended name：Zinc finger and BTB domain-containing protein 7A
EC number：
Alternative names：(Leukemia/lymphoma-related factor) (POZ and Krueppel erythroid myeloid ontogenic factor) (POK erythroid myeloid ontogenic factor) (Pokemon)
Cleaved into：
GeneID：16969
Gene names (primary )：Zbtb7a
Gene names (synonym )：Lrf Zbtb7
Gene names (ORF )：
Length：569
Mass：60281
Sequence：MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSHVCADLLERQILAADDVGDASQPDGAGPTDQRNLLRAKEYLEFFRSNPMNSLPPTAFPWSGFGAPDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPAGDGDEGDSTPGLWPERDEDAPPGGLFPPPTAPPATTQNGHYGRAGAGTGEEEAAALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLAASTLLQQMMSSVGRAGDSDEESRTDDKGVMDYYLKYFSGAHEGDVYPAWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGVPPDVPAGAGAPPGLPDAPRNGQEKHFKDEEEDEEEASPDGSGRLNVAGSGGDDGAGGPAVATAEGNFAT
Tissue specificity：Widely expressed (PubMed:9927193). In normal thymus, expressed in medullary epithelial cells and Hassle's corpuscles (at protein level) (PubMed:15662416). In the spleen, mainly expressed in the white pulp germinal centers (at protein level) (PubMed:15662416). Up-regulated in thymic lymphomas (PubMed:15662416). {ECO:0000269|PubMed:15662416, ECO:0000269|PubMed:9927193}.
Induction：
Developmental stage：Expressed at 9.5-10.0 dpc in limb buds, pharyngeal arches, tail bud, placenta and neural tube (PubMed:9927193). Up-regulated during adipocyte differentiation (PubMed:14701838). {ECO:0000269|PubMed:14701838, ECO:0000269|PubMed:9927193}.
Protein families：