PSMG1_MOUSE Q9JK23
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK23
Recommended name:Proteasome assembly chaperone 1
EC number:
Alternative names:(Down syndrome critical region protein 2 homolog)
Cleaved into:
GeneID:56088
Gene names (primary ):Psmg1
Gene names (synonym ):Dscr2
Gene names (ORF ):
Length:289
Mass:33104
Sequence:MAATFFGEVVKAPCRAGTEEEEEEEEQSRRDTPEDREVRRQLARKREVRLLRRQTETSLEAVLLETHPCSKFIIAVGSNATAFLSAFVMNSGVWEEVGCAKLWNEWCRTTDTVRLSPTDVFCVFYQLKSDPSVFLCQCSCYIAEDQQFQWLEKVFGFQPRKSMQVTVLTCRHITDYKTPESTCSLSSPFLRALKTQTFKDALCCPLLEQPNIVHDLSAAVLSYCQVWKIPAVLYLCYTDVMKLDRVTVEAFKPLLSSRSLKCLVKNIPESTEILKKLMTTNEIQSNIYT
Tissue specificity:Highly expressed in testis with moderate expression in brain, liver and kidney and low levels in heart, skeletal muscle and pancreas. {ECO:0000269|PubMed:10872820}.
Induction:
Developmental stage:Expressed at a fairly constant level throughout embryonic development. {ECO:0000269|PubMed:10872820}.
Protein families:PSMG1 family