RHOH_MOUSE Q9D3G9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D3G9
Recommended name：Rho-related GTP-binding protein RhoH
EC number：
Alternative names：
Cleaved into：
GeneID：74734
Gene names (primary )：Rhoh
Gene names (synonym )：Arhh
Gene names (ORF )：
Length：191
Mass：21324
Sequence：MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTAGNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWISEIRSNLPCTPVLVVATQTDQREVGPHRASCINAIEGKRLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRRKLFSINECKIF
Tissue specificity：Expression is widespread in hematopoietic cells, including in bone marrow progenitor cells and in differentiated myeloid as well as lymphoid cells. Expressed at high levels in the thymus and mast cells, found in spleen and low-density bone marrow (LDBM) cells and is detected at a low level in neutrophils. In the thymus it is detected in thymocytes of the thymic cortex but not in non-lymphoid cells of fibrovascular and fibroadipose tissues. Expressed in T-cells, B-cells and mast cells. {ECO:0000269|PubMed:15494435, ECO:0000269|PubMed:19124738}.
Induction：
Developmental stage：Expressed at all stages of thymocyte development, with relative peaks at the DN3 and DP stages. {ECO:0000269|PubMed:17119112}.
Protein families：Small GTPase superfamily, Rho family