CFA20_MOUSE Q8BTU1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BTU1
Recommended name：Cilia- and flagella-associated protein 20
EC number：
Alternative names：(Gene trap locus 3 protein)
Cleaved into：
GeneID：14894
Gene names (primary )：Cfap20
Gene names (synonym )：Gtl3
Gene names (ORF )：
Length：193
Mass：22748
Sequence：MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLSDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
Tissue specificity：Widely expressed, with highest levels in testis and lowest in muscle. {ECO:0000269|PubMed:8688464}.
Induction：
Developmental stage：Expressed at high levels in germinal vesicle stage oocytes at the mRNA level. Expression progressively decreases until blastocyst stage (PubMed:15803458). Detected in later embryonic stages from 9.5 to 19.5 dpc. At 11.5 dpc, the expression is widespread, with no preference for any particular organ or structure (PubMed:8688464). {ECO:0000269|PubMed:15803458, ECO:0000269|PubMed:8688464}.
Protein families：CFAP20 family