PHLA2_MOUSE O08969
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08969
Recommended name:Pleckstrin homology-like domain family A member 2
EC number:
Alternative names:(Imprinted in placenta and liver protein) (Protein 50C15)
Cleaved into:
GeneID:22113
Gene names (primary ):Phlda2
Gene names (synonym ):Ipl Tssc3
Gene names (ORF ):
Length:144
Mass:16727
Sequence:MASKIVMSSKTVKTSDEILCEGELEKRSDSLFQVWKKKRCVLTADRLRLFSGKTSPAKELFFHSILKVDCVEHTSKYVYFTIVTNYYKEIDFRCTVESCWNAAITMALIDFQNRRALQDFPRYRYQRSESEMPSEPGEQSALGP
Tissue specificity:Specifically expressed at high levels in extraembryonic tissues in the developing conceptus (at protein level). Expressed in placenta and yolc sac. Expressed at low levels in fetal liver and kidney. {ECO:0000269|PubMed:10594239}.
Induction:Maternal Phlda2 allele is activated, while paternal Phlda2 is repressed due to genomic imprinting. {ECO:0000269|PubMed:15327781}.
Developmental stage:Expressed at high levels in the very early conceptus limited to polar trophectoderm. Strongly expressed in the ectoplacental cone shortly after implantation at 5.5 dpc, and the high expression remains restricted to the extraembryonic tissues at later stages. By 10.5 dpc expression is restricted to the labyrinthine trophoblast and the endodermal component of the visceral yolk sac. Between 12.5 and 14.4 dpc expression in placenta decreases, due to a number of expressing cells. On day 12 of gestation, the abundant expressing cells are trophoblast at the chorionic plate, and clustered type II trophoblast deeper in the labyrinth. Less expressed by terminally differentiated trophoblast. As early as 14.5 dpc, becomes confined to a monolayer of cells at the chorionic plate and to rare cells in septa that protrude into the labyrinth (at protein level). {ECO:0000269|PubMed:10594239, ECO:0000269|PubMed:12032310}.
Protein families:PHLDA2 family