GFRA2_MOUSE O08842
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08842
Recommended name：GDNF family receptor alpha-2
EC number：
Alternative names：(GDNF receptor alpha-2) (GDNFR-alpha-2) (GFR-alpha-2) (GDNF receptor beta) (GDNFR-beta) (Neurturin receptor alpha) (NRTNR-alpha) (NTNR-alpha) (TGF-beta-related neurotrophic factor receptor 2)
Cleaved into：
GeneID：14586
Gene names (primary )：Gfra2
Gene names (synonym )：Gdnfrb Trnr2
Gene names (ORF )：
Length：464
Mass：51727
Sequence：MILANAFCLFFFLDETLRSLASPSSPQGSELHGWRPQVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYRTITSCPADNYQACLGSYAGMIGFDMTPNYVDSNPTGIVVSPWCNCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTDVNMSPKGPTFSATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSIQEQGLKANNSKELSMCFTELTTNISPGSKKVIKLYSGSCRARLSTALTALPLLMVTLAQ
Tissue specificity：Neurons of the superior cervical and dorsal root ganglia, and adult brain and testis. Low level in the substantia nigra, spleen and adrenal gland (PubMed:9182803). Isoform 1, isoform 2 and isoform 3 are all expressed in brain, liver, ileum, spleen, heart and kidney (PubMed:9875703). In brain, isoform 1 is most abundant, isoform 2 slightly less and isoform 3 is lowest. No significant levels of isoform 1, isoform 2 or isoform 3 expression in testis (PubMed:12829325). {ECO:0000269|PubMed:12829325, ECO:0000269|PubMed:9182803, ECO:0000269|PubMed:9875703}.
Induction：
Developmental stage：Expressed at low level in the ventral mesencephalon at 14 dpc. Highly expressed in the developing dorsal root ganglia (PubMed:9182803). Isoform 1, isoform 2 and isoform 3 are all highly expressed in the late embryonic development (15 dpc and 17 dpc) (PubMed:12829325). {ECO:0000269|PubMed:12829325, ECO:0000269|PubMed:9182803}.
Protein families：GDNFR family