TF2L1_MOUSE Q3UNW5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UNW5
Recommended name:Transcription factor CP2-like protein 1
EC number:
Alternative names:(CP2-related transcriptional repressor 1) (CRTR-1)
Cleaved into:
GeneID:81879
Gene names (primary ):Tfcp2l1
Gene names (synonym ):Crtr1 Tcfcp2l1
Gene names (ORF ):
Length:479
Mass:54737
Sequence:MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENGARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEYQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPSKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNESGDYSEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVPYQANNTPSPSYNGSPNSFGLREGNSSPNHPVEPLPLGSDHLLPSASIQDAQQWLHRNRFSQFCWLFASFSGADLLKMSRDDLVQVCGPADGIRLFNAIKGRNVRPKMTIYVCQELEQNQLPLPQKQDDSGDNSLCVYHAIFLEELTTLELTEKIASLYSIPPQHIHRVYRQGPAGIHVVVSNEMVQNFQDESCFILSTLKAESNDGYHIILKCGL
Tissue specificity:Highly expressed in placenta, testis, small intestine, kidney and stomach (PubMed:11073954, PubMed:17079272). Low levels of expression in lung, mesenteric lymph nodes, muscle, ovary, and thymus (PubMed:11073954). No expression was detected in brain, heart, liver, and spleen (PubMed:11073954). Expressed in eccrine glands in the palm (PubMed:11073954). Expression is prominent in both kidney collecting ducts intercalated (IC) and principal (PC) cells (PubMed:28577314). Also expressed in the thick limb of Henle and connecting segments of the nephron (PubMed:28577314). {ECO:0000269|PubMed:11073954, ECO:0000269|PubMed:17079272, ECO:0000269|PubMed:28577314}.
Induction:
Developmental stage:Expressed at low levels in 10.5- and 11.5-dpc embryos. Expression was not detected at 12.5- and 13.5-dpc. Highly expressed in the epithelial monolayer lining in a subset of tubules of embryonic kidney cortex. Low levels of expression were detected in 16.5-dpc embryonic intestine, limb, lung, and skin. No expression was detected in the brain. Expression is regulated in at least two distinct sites, the pluripotent cells of the developing embryo and the epithelial cells lining the embryonic kidney distal convoluted tubules. Expressed in the ducts of submandibular and sublingual glands, isolated submandibular gland, parotid and lachrymal glands and nasal gland in 16 dpc embryos. At birth, the expression is detected in minor nasal glands in the olfactory epithelium, ducts of the mammary gland, male reproductive system, endolymphatic sac and lung. Expressed during renal development; first detected in the ureteric epithelium, at the distal end of the S-shaped body in nephron and subsequently in all nephric tubule, with expression localizing to more distal regions in the nephron during the maturation of the kidney. {ECO:0000269|PubMed:11073954, ECO:0000269|PubMed:17079272}.
Protein families:Grh/CP2 family, CP2 subfamily