WDR74_MOUSE Q8VCG3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VCG3
Recommended name:WD repeat-containing protein 74
EC number:
Alternative names:
Cleaved into:
GeneID:107071
Gene names (primary ):Wdr74
Gene names (synonym ):
Gene names (ORF ):
Length:384
Mass:42636
Sequence:MATASARWNHVWVGTETGILKGVNLQRKHAANFTPSGQPRREEAVNALCWGTGGETQILVGCADRTVRYFNAEEGTFLSQRYCPGGEGTFRGLAQADGTLITCVDSGILRVWCENDKEASSDPLLELKVGPGVCRMRQDPTHTHVVATCGKENALKVWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDTQFLPGSQKLVTCTGYHQVRVYDPVSPQRRPVLEATYGEYPLTAMTLTPEGNSVIVGNTHGQLAEIDFRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIRNPRGLEHKVYLKSQLNCLLLSGRDNWEDEPQEPQEPNQVPSEDTETDELWASLEAAAKRKLPDLDQTQGALQRRKKKKRPGSTSP
Tissue specificity:
Induction:
Developmental stage:Expressed at low levels in MII oocytes and 1-cell embryos and increases through subsequent cleavage stage divisions. The peak of mRNA expression occurs at the morula stage, with a slight decrease in blastocyst embryos. {ECO:0000269|PubMed:21799883}.
Protein families: