THOC7_MOUSE   Q7TMY4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TMY4

Recommended name:THO complex subunit 7 homolog

EC number:

Alternative names:(Ngg1-interacting factor 3-like protein 1-binding protein 1)

Cleaved into:

GeneID:66231

Gene names  (primary ):Thoc7

Gene names  (synonym ):Nif3l1bp1

Gene names  (ORF ):

Length:204

Mass:23715

Sequence:MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDDKLSEVDEAQESTMEADPKP

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:12951069}.

Induction:

Developmental stage:Expressed at low levels in testis between P3 and P14. Expression in testis increases at P20 and reaches maximum levels in adult. {ECO:0000269|PubMed:16465402}.

Protein families:THOC7 family


   💬 WhatsApp