TR19L_MOUSE Q8BX43
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BX43
Recommended name：Tumor necrosis factor receptor superfamily member 19L
EC number：
Alternative names：
Cleaved into：
GeneID：320100
Gene names (primary )：Relt
Gene names (synonym )：Tnfrsf19l
Gene names (ORF )：
Length：436
Mass：46518
Sequence：MSLQGLMMKRTLLCWPLSCLFVLLPWPLATPTPITPWLCPPGKEPDPDPGQGTLCRTCPPGTFSASWNSYPCQPHYRCSLQKRLEAQAGTATHDTMCGDCQHGWFGPQGVPHVPCQPCSKAPPSTGGCDESGRRGRRGVEVAAGTSSNGEPRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAQKEVGPSPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVPRLLPASPSIPHICPHHHHLHTVQGLASLSGPCCSRCSQKWPEVLLSPEAAAATTPAPTLLPTASRAPKASAKPGRQGEITILSVGRFRVARIPEQRTSSLLSEVKTITEAGPSEGDLPDSPQPGLPPEQRALLGSGGSHTKWLKPPAENKAEENRYVVRLSESNLVI
Tissue specificity：Expressed in the teeth. {ECO:0000269|PubMed:30506946}.
Induction：
Developmental stage：Expressed by secretory stage ameloblasts and by odontoblasts at postnatal day 5. It is not detected in maturation stage ameloblasts and only residual expression is observed in odontoblasts by postnatal day 12. {ECO:0000269|PubMed:30506946}.
Protein families：RELT family