APMAP_MOUSE Q9D7N9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D7N9
Recommended name:Adipocyte plasma membrane-associated protein
EC number:
Alternative names:(Protein DD16)
Cleaved into:
GeneID:71881
Gene names (primary ):Apmap
Gene names (synonym ):
Gene names (ORF ):
Length:415
Mass:46434
Sequence:MSEADGLRQRRPLRPQVVTDDGQVPEVKEGSSFSGRVFRMTFLMLAVSLAIPLLGAMMLLESPIDPQSFSFKEPPFMFGVLHPNTKLRQAERLFENQLSGPESIVNIGDVLFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPTCGRPLGIRAGPNGTLFVVDAYKGLFEVNPQKRSVKLLLSSETPIEGKKMSFVNDLTVTRDGRKIYFTDSSSKWQRRDYLLLVMEATDDGRLLEYDTVTKEVKVLLDQLQFPNGVQLSPEEDFVLVAETTMARIRRVYVSGLMKGGADMFVENMPGFPDNIRPSSSGGYWVAAATIRANPGFSMLDFLSDKPFIKRMIFKMFSQETVMKFVPRYSLVLEVSDSGAFRRSLHDPDGQVVTYVSEAHEHDGYLYLGSFRSPFICRLSLQSI
Tissue specificity:Strongly expressed in adipose tissue. Highly expressed in liver, heart, and kidney. Expressed at intermediate level in brain and lung. Weakly expressed in spleen, skeletal muscle and testis.
Induction:
Developmental stage:Expressed during adipocyte differentiation. Expression appears 3 days following induction of adipose conversion.
Protein families:Strictosidine synthase family