PDCD2_MOUSE   P46718


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P46718

Recommended name:Programmed cell death protein 2

EC number:

Alternative names:(Zinc finger protein Rp-8)

Cleaved into:

GeneID:18567

Gene names  (primary ):Pdcd2

Gene names  (synonym ):Rp8

Gene names  (ORF ):

Length:343

Mass:38342

Sequence:MAAAAPGPVELGFAEEAPAWRLRSEQFPSKVGGRPAWLGLAELPGPGALACARCGRPLAFLLQVYAPLPGRDDAFHRSLFLFCCREPLCCAGLRVFRNQLPRNNAFYSYEPPSETEALGTECVCLQLKSGAHLCRVCGCLAPMTCSRCKQAHYCSKEHQTLDWRLGHKQACTQSDKIDHMVPDHNFLFPEFEIVTETEDEILPEVVEMEDYSEVTGSMGGIPEEELDSMAKHESKEDHIFQKFKSKIALEPEQILRYGRGIKPIWISGENIPQEKDIPDCPCGAKRIFEFQVMPQLLNHLKADRLGRSIDWGVLAVFTCAESCSLGSGYTEEFVWKQDVTDTP

Tissue specificity:

Induction:

Developmental stage:Expressed during apoptosis of lymphoid and myeloid cells.

Protein families:


   💬 WhatsApp