CCL27_MOUSE Q9Z1X0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1X0
Recommended name:C-C motif chemokine 27
EC number:
Alternative names:(CC chemokine ILC) (Cutaneous T-cell-attracting chemokine) (CTACK) (ESkine) (IL-11 R-alpha-locus chemokine) (ALP) (mILC) (Skinkine) (Small-inducible cytokine A27)
Cleaved into:
GeneID:100039863
Gene names (primary ):Ccl27
Gene names (synonym ):Ilc Scya27
Gene names (ORF ):
Length:120
Mass:13464
Sequence:MMEGLSPASSLPLLLLLLSPAPEAALPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSHPQQQN
Tissue specificity:Isoform 1 is predominantly expressed in placenta and weakly in skin. Isoform 2 is predominantly expressed in testes and brain, weakly in kidney and liver and even lower in heart and muscle. Low expression of both isoforms in other tissues.
Induction:
Developmental stage:Expressed during development.
Protein families:Intercrine beta (chemokine CC) family