NKX22_MOUSE P42586
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P42586
Recommended name：Homeobox protein Nkx-2.2
EC number：
Alternative names：(Homeobox protein NK-2 homolog B)
Cleaved into：
GeneID：18088
Gene names (primary )：Nkx2-2
Gene names (synonym )：Nkx-2.2 Nkx2b
Gene names (ORF )：
Length：273
Mass：30126
Sequence：MSLTNTKTGFSVKDILDLPDTNDEDGSVAEGPEEESEGPEPAKRAGPLGQGALDAVQSLPLKSPFYDSSDNPYTRWLASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGGGDAGKKRKRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGMEVTPLPSPRRVAVPVLVRDGKPCHALKAQDLAAATFQAGIPFSAYSAQSLQHMQYNAQYSSASTPQYPTAHPLVQAQQWTW
Tissue specificity：Expressed in restricted areas of the developing CNS: the hindbrain and forebrain, and pancreas.
Induction：
Developmental stage：Expressed during embryogenesis.
Protein families：NK-2 homeobox family