NOE3_MOUSE   P63056


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63056

Recommended name:Noelin-3

EC number:

Alternative names:(Olfactomedin-3) (Optimedin)

Cleaved into:

GeneID:229759

Gene names  (primary ):Olfm3

Gene names  (synonym ):Noe3

Gene names  (ORF ):

Length:478

Mass:54886

Sequence:MSAPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSAPDTLTQISPKEGWQVYSSAQDPDGRCICTVVAPEQNLCSRDAKSRQLRQLLEKVQNMSQSIEVLNLRTQRDFQYVLKMETQMKGLKAKFRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSSVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNGSLYFNKYQSNIIIKYSFDLGRVLAQRSLEYAGFHNVYPYTWGGFSDIDLMADEIGLWAVYATNQNAGNIVISQLNQDTLEVMKSWSTGYPKRSAGESFMICGTLYVTNSHLTGAKVYYSYSTKTSTYEYTDIPFHNQYFHISMLDYNARDRALYAWNNGHQVLFNVTLFHIIKTEDDT

Tissue specificity:Expressed in the brain (at protein level). {ECO:0000269|PubMed:22632720}.

Induction:

Developmental stage:Expressed during embryonic development starting from 7 dpc. Expression increases moderately during embryonic development and remains stable in the postnatal brain. {ECO:0000269|PubMed:21228389}.

Protein families:


   💬 WhatsApp