CFC1_MOUSE P97766
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97766
Recommended name：Cryptic protein
EC number：
Alternative names：
Cleaved into：
GeneID：12627
Gene names (primary )：Cfc1
Gene names (synonym )：
Gene names (ORF )：
Length：202
Mass：21792
Sequence：MRANSPTQGISLKMHQARPLFLVTVALQLIGLGYSYQSEGDGAREVSNILSPVIPGTTLDRTLSNSSRKNDIPEGARLWDSLPDSSTLGESAVPVSRCCHNGGTCVLGSFCVCPAYFTGRYCEHDQRRRDCGALGHGAWTLHSCRLCRCIFSALYCLPHQTFSHCDLKSFLSSGARGSRECSIPSLLLLVLCLLLQGVAGKG
Tissue specificity：No expressed in adult tissues. {ECO:0000269|PubMed:9053319}.
Induction：
Developmental stage：Expressed during gastrulation (from 6.5 dpc to 11 dpc) in two spatial domains that correspond to the axial and lateral mesoderm. In the first domain expression is progressively localized to the anterior primitive streak, the head process, and the node and notochordal. In the second domain, expression is initially concentrated in the lateral region of the egg cylinder, and is later found circumferentially in the intermediate and lateral plate mesoderm. Furthermore, the expression can also be detected at the early head-fold stage in the midline neuroectoderm, and consequently is an early marker for the prospective floor plate of the neural tube. Expression ceases at the end of gastrulation, and has not been observed in later embryonic stages. {ECO:0000269|PubMed:9053319}.
Protein families：EGF-CFC (Cripto-1/FRL1/Cryptic) family