OSTN_MOUSE P61364
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61364
Recommended name：Osteocrin
EC number：
Alternative names：(Musclin)
Cleaved into：Processed Osteocrin
GeneID：239790
Gene names (primary )：Ostn
Gene names (synonym )：
Gene names (ORF )：
Length：130
Mass：14438
Sequence：MLDWRLASTHFILAMIVMLWGSGKAFSVDLASQEFGTASLQSPPTAREEKSATELSAKLLRLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRKAVDHSKKRFGIPMDRIGRNRLSSSRG
Tissue specificity：Expressed in skeletal muscle and to a much lesser extent in bone, brown adipose tissue, spleen and testis (PubMed:14523025, PubMed:15044443, PubMed:26668395). Not expressed in neurons (PubMed:27830782). {ECO:0000269|PubMed:14523025, ECO:0000269|PubMed:15044443, ECO:0000269|PubMed:26668395, ECO:0000269|PubMed:27830782}.
Induction：Is regulated by nutritional changes (PubMed:15044443). Is up-regulated dose-dependently by insulin (PubMed:15044443). Is down-regulated dose-dependently by forskolin (PubMed:15044443). Induced in muscle following physical exercise (PubMed:26668395). {ECO:0000269|PubMed:15044443, ECO:0000269|PubMed:26668395}.
Developmental stage：Expressed during matrix production and maturation. Also expressed during myocyte differentiation. {ECO:0000269|PubMed:14523025, ECO:0000269|PubMed:15044443}.
Protein families：Osteocrin family