H32_MOUSE P84228
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84228
Recommended name：Histone H3.2
EC number：
Alternative names：(H3-clustered histone 13) (H3-clustered histone 14) (H3-clustered histone 15) (H3-clustered histone 2) (H3-clustered histone 3) (H3-clustered histone 4) (H3-clustered histone 6) (H3-clustered histone 7)
Cleaved into：
GeneID：15077
Gene names (primary )：H3c2; H3c3; H3c4; H3c6; H3c7; H3c13; H3c14; H3c15
Gene names (synonym )：H3-53 H3.2 H3b Hist1h3b; H3-143 Hist1h3c; H3-B Hist1h3d; H3-F Hist1h3e; H3.2-221 H3f Hist1h3f; H3.2-616 Hist2h3b; H3.2-615 Hist2h3c1 Hist2h3ca1; H3.2-614 Hist2h3c2 Hist2h3ca2
Gene names (ORF )：; ; ; ; ; ; ;
Length：136
Mass：15388
Sequence：MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Tissue specificity：
Induction：
Developmental stage：Expressed during S phase, then expression strongly decreases as cell division slows down during the process of differentiation.
Protein families：Histone H3 family