CST9_MOUSE Q9Z0H6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0H6
Recommended name：Cystatin-9
EC number：
Alternative names：(Testatin)
Cleaved into：
GeneID：13013
Gene names (primary )：Cst9
Gene names (synonym )：Cresp
Gene names (ORF )：
Length：137
Mass：16094
Sequence：MSCPLRKKALPLTMLLLLLSFHVLITPVSKANKETNRSVHFIPTVEFAVNTFNQESQDEYAYRMEHIMSSWREKVNFPTVYSMRLQLRRTICKKFEESLDICPFQESHGLNNTFTCLFTVGTYPWITKFKLFRSVCS
Tissue specificity：Expression is restricted to fetal gonads and adult testis. {ECO:0000269|PubMed:9826679}.
Induction：
Developmental stage：Expressed during testis cord formation in pre-Sertoli cells, at a time immediately after the peak of SRY expression. {ECO:0000269|PubMed:9826679}.
Protein families：Cystatin family