ZP3_MOUSE P10761
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10761
Recommended name：Zona pellucida sperm-binding protein 3
EC number：
Alternative names：(Sperm receptor) (Zona pellucida glycoprotein 3) (Zp-3) (Zona pellucida protein C)
Cleaved into：Processed zona pellucida sperm-binding protein 3
GeneID：22788
Gene names (primary )：Zp3
Gene names (synonym )：Zp-3 Zpc
Gene names (ORF )：
Length：424
Mass：46304
Sequence：MASSYFLFLCLLLCGGPELCNSQTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKANDQTVEGWTASAQTSVALGLGLATVAFLTLAAIVLAVTRKCHSSSYLVSLPQ
Tissue specificity：Expressed in oocytes.
Induction：
Developmental stage：Expressed during the 2-week growth phase of oogenesis, prior to ovulation.
Protein families：ZP domain family, ZPC subfamily