SLAP1_MOUSE Q60898
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q60898
Recommended name：Src-like-adapter
EC number：
Alternative names：(Src-like-adapter protein 1) (SLAP-1) (mSLAP)
Cleaved into：
GeneID：20491
Gene names (primary )：Sla
Gene names (synonym )：Slap Slap1
Gene names (ORF )：
Length：281
Mass：31681
Sequence：MGNSMKSTSPPSERPLSSSEGLESDFLAVLTDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKIGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVTHYSEVADGLCCVLTTPCLAQNIPAPTSHPSPCTSPGSPVTLRQKTFDWKRVSRLQEGSEGAENPLRVDESLFSYGLRESIASYLSLTGDDSSSFDRKKKSLSLMYTGSKRKSSFFSAPQYFED
Tissue specificity：Predominantly expressed in lymphoid tissues. Highly expressed in spleen, thymus and lymph nodes. Weakly expressed in lung and brain. Expressed in T-cells and at low level in B-cells. {ECO:0000269|PubMed:7543898}.
Induction：
Developmental stage：Expressed during thymocyte maturation. Weakly expressed in CD4(-) CD8(-) thymocytes, strongly expressed in CD4(+) CD8(+) thymocytes, while expression decreases in more mature cells. {ECO:0000269|PubMed:11567635}.
Protein families：