EGFL7_MOUSE Q9QXT5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXT5
Recommended name：Epidermal growth factor-like protein 7
EC number：
Alternative names：(EGF-like protein 7) (Multiple epidermal growth factor-like domains protein 7) (Multiple EGF-like domains protein 7) (NOTCH4-like protein) (Vascular endothelial statin) (VE-statin) (Zneu1)
Cleaved into：
GeneID：353156
Gene names (primary )：Egfl7
Gene names (synonym )：Megf7
Gene names (ORF )：
Length：275
Mass：29765
Sequence：MWGSGELLVAWFLVLAADGTTEHVYRPSRRVCTVGISGGSISETFVQRVYQPYLTTCDGHRACSTYRTIYRTAYRRSPGVTPARPRYACCPGWKRTSGLPGACGAAICQPPCGNGGSCIRPGHCRCPVGWQGDTCQTDVDECSTGEASCPQRCVNTVGSYWCQGWEGQSPSADGTRCLSKEGPSPVAPNPTAGVDSMAREEVYRLQARVDVLEQKLQLVLAPLHSLASRSTEHGLQDPGSLLAHSFQQLDRIDSLSEQVSFLEEHLGSCSCKKDL
Tissue specificity：Expressed specifically by endothelial cells of the highly vascularized organs heart, lung and kidney. {ECO:0000269|PubMed:14592969, ECO:0000269|PubMed:15162510}.
Induction：
Developmental stage：Expressed early during mouse embryogenesis in the yolk sac mesoderm and in the developing vascular system. At 7.5 dpc, it is expressed in the primitive blood islands where the first endothelial cells differentiate. At 10.5 and 13.5 dpc expression is restricted to endothelial cells. {ECO:0000269|PubMed:14592969, ECO:0000269|PubMed:15162510}.
Protein families：