PRS37_MOUSE   Q9DAA4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DAA4

Recommended name:Probable inactive serine protease 37

EC number:

Alternative names:(Probable inactive trypsin-X2)

Cleaved into:

GeneID:67690

Gene names  (primary ):Prss37

Gene names  (synonym ):Tryx2

Gene names  (ORF ):

Length:237

Mass:26698

Sequence:MKLIIYLTILAGTALVTHSSVQKEDHAPYLAYLKSNFNPCVGVLIKASWVLAPSHCYLPNLRVMLGNFKSRVRDGTEQTIYPIQIIRYWNYSHTAPQDDLMLIKLAKPATFNHKVQVLPIATTNVRPGTVCTLSGLDWSQENNGRHPDLRQNLEAPVMTDKDCQKTQQGSSHRNSLCVRFVKVFSRIFGEVAVATVICKNKLQGIEVGHFMGGDVGIYTNIYSYVPWIEKTTKEKMT

Tissue specificity:Testis-specific (PubMed:23553430). Expressed in spermatids (PubMed:23553430). Weakly expressed in mature sperm (at protein level) (PubMed:23553430). {ECO:0000269|PubMed:23553430}.

Induction:

Developmental stage:Expressed exclusively in the spermatids at steps 9-14 of spermiogenesis (PubMed:23553430). {ECO:0000269|PubMed:23553430}.

Protein families:Peptidase S1 family


   💬 WhatsApp