NOBOX_MOUSE   Q8VIH1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VIH1

Recommended name:Homeobox protein NOBOX

EC number:

Alternative names:(Homeodomain-containing protein OG-2) (Newborn ovary homeobox protein) (Oocyte-specific homeobox protein)

Cleaved into:

GeneID:18291

Gene names  (primary ):Nobox

Gene names  (synonym ):Og2x

Gene names  (ORF ):

Length:527

Mass:57565

Sequence:MEPTEKLCKKMQGQEAGDKPRTAALETEGPLQDSALPIQDDQDKQSSLPRASLGKRPLSKTSEELMDAGTCRVHKAPTAAACGPQSEEEGCSPPERKAESLKPSISAVPGQATAGSLNSHEGDLKKESLEVTCQFRKKTRTLYRSDQLEELERIFQEDHYPDSDKRHEISQMVGVTPQRIMVWFQNRRAKWRKVEKLNEKETKNGPAAPSADSSQHRSAPELLDPMPTDLEPGPVPPENILDVFPEPPMLLTSEQTLTPFQNNEGAERVAVTPPLLSPPPIRRANLPLPLGPVQTPQVLPPMRDVPGSDSIYKDKAYVSWGTSIASPPTYSNLEDLGSQDYQASSQLGSFQLSQAPHLPLFPSLQSQFPYLPPFPYPIPSSMPFLPPEDSLFSFPFGFSGDSSQDYCPGPPPGQILLQPPAENMGTGPWSGHCLPEPPFPRPHYPQALGQPLGAEGYFPNLLPTPYALTMSKQSSLGLNGLLEGTRVETGSSLSKMSDEQTSSSLEQPALEEVRDKNKNSHAAGAKE

Tissue specificity:Specifically expressed in ovaries and testes. In ovaries, expressed in oocytes from primordial through antral follicles but not in granulosa cells, theca cells and corpora lutea. {ECO:0000269|PubMed:11804785}.

Induction:

Developmental stage:Expressed from 15.5 dpc. {ECO:0000269|PubMed:8855241}.

Protein families:


   💬 WhatsApp