RSPO3_MOUSE Q2TJ95
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2TJ95
Recommended name：R-spondin-3
EC number：
Alternative names：(Cabriolet) (Cysteine-rich and single thrombospondin domain-containing protein 1) (Cristin-1) (Nucleopondin) (Roof plate-specific spondin-3)
Cleaved into：
GeneID：72780
Gene names (primary )：Rspo3
Gene names (synonym )：
Gene names (ORF )：
Length：277
Mass：31454
Sequence：MHLRLISCFFIILNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKVDCDTCFNKNFCTKCKSGFYLHLGKCLDSCPEGLEANNHTMECVSIVHCEASEWSPWSPCMKKGKTCGFKRGTETRVRDILQHPSAKGNLCPPTSETRTCIVQRKKCSKGERGKKGRERKRKKLNKEERKETSSSSDSKGLESSIETPDQQENKERQQQQKRRARDKQQKSVSVSTVH
Tissue specificity：Highly expressed in endothelial cells (PubMed:26766444). {ECO:0000269|PubMed:26766444}.
Induction：
Developmental stage：Expressed from day 7.5 in the primitive streak. At day 9.5, it is expressed in various neural and mesodermal derivatives, mainly along dorsal neural tube, diencephalon, somites and tailbud mesoderm. Strongly expressed in limb buds, particularly in the morphogenetically active region such as the apical ectodermal ridge (AER). {ECO:0000269|PubMed:15469841}.
Protein families：R-spondin family