OC90_MOUSE Q9Z0L3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z0L3
Recommended name：Otoconin-90
EC number：
Alternative names：(Oc90) (Otoconin-95) (Oc95)
Cleaved into：
GeneID：18256
Gene names (primary )：Oc90
Gene names (synonym )：Onc-95 Pla2ll
Gene names (ORF )：
Length：485
Mass：52445
Sequence：MIMLLMVGMLMAPCVGAHALDTPNPQELPPGLSKNINITFFNGVFKNVESVAEIFDCLGSHFTWLQAVFTNFPLLLQFVNSMRCVTGLCPRDFEDYGCACRFEMEGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVDCTNKQITCESEDPCERLLCTCDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATLLPRGIPEKPTDTSQIALSGEVAGEVRADTLTTLSRTKSVQDLQDTQASRTTSSPGSAEIIALAKGTTHSAGIKPLRLGVSSVDNGSQEAAGKACDRLAFVHLGDGDSMTAMLQLGEMLFCLTSHCPEEFETYGCYCGREGRGEPRDTLDRCCLSHHCCLEQMRQVGCLHGRRSQSSVVCEDHMAKCVGQSLCEKLLCACDQMAAECMASAFFNQSLKSPDGAECQGEPVSCEDGMLQGTLASSVDSSSEENSEEAPPQMERLRRFLEKPPGPLGARPLGGK
Tissue specificity：In the embryo, highly expressed in the developing otocyst with weak expression in the brain. Also expressed in nonsensory epithelia of both the vestibular and cochlear portions of the developing inner ear. Not expressed in adult or embryonic macular sensory epithelia. {ECO:0000269|PubMed:9892667}.
Induction：
Developmental stage：Expressed from embryonic day 9.5. {ECO:0000269|PubMed:9892667}.
Protein families：Phospholipase A2 family