ZN704_MOUSE Q9ERQ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ERQ3
Recommended name：Zinc finger protein 704
EC number：
Alternative names：(Glucocorticoid-induced gene 1 protein)
Cleaved into：
GeneID：170753
Gene names (primary )：Znf704
Gene names (synonym )：Gig1 Zfp704
Gene names (ORF )：
Length：566
Mass：61150
Sequence：MQARRLAKRPSLGSRRGGAAPAPAPEAAALGLPPPGPSPAAAPGSWRPPLPPPRGTGPSRAAAASSPVLLLLGEEDEDEEGAGRRRRTRGRVTEKPRGVAEEEDDDEEEDEEVVVEVVDGDEDDEDAEERFVPLGPGRALPKGPARGAVKVGSFKREMTFTFQSEDFRRDSSKKPSHHLFPLAMEEDVRTADTKKTSRVLDQEKETRSVCLLEQKRKVVSSNIDVPPARKSSEELDMDKVTAAMVLTSLSTSPLVRSPPVRPNEGLSGSWKEGAPSSSSSSGYWSWSAPSDQSNPSTPSPPLSADSFKPFRSPAPPDDGIDEADASNLLFDEPIPRKRKNSMKVMFKCLWKSCGKVLNTAAGIQKHIRAVHLGRVGESDCSDGEEDFYYTEIKLNTDATAEGLNTVAPVSPSQSLASAPAFPIPDSSRTETPCAKTDTKLVTPLSRSAPTTLYLVHTDHAYQATPPVTIPGSAKFTPNGSSFSISWQSPPVTFTGVPVSPPHHPTAGSGEQRQHAHTALSSPPRGTVTLRKPRGEGKKCRKVYGMENRDMWCTACRWKKACQRFID
Tissue specificity：
Induction：
Developmental stage：Expressed from embryonic stage 9.5 dpc to 14.5 dpc. Detected in tissues from all three germ layers, with particularly strong expression in mesodermal derivatives. Strongly expressed in somites and also detected in limb bud mesenchyme, apical epidermal ridge (AER), otic vesicle, and nephrogenic mesenchyme. Expression in somites follows an anterior-to-posterior gradient of activation and localizes to somite myotomes. In limbs, first detected at stage 10.5 dpc, probably in a subset of muscle precursor cells. Expression in developing muscles continues during stage 14.5 dpc. Found in a subset of tendon precursors, particularly in the distal region of the limb. Also detected in ectoderm at the digit tips. Other notable sites of expression at stage 11.5 dpc include skin epithelium in the posterior embryo, thyroid rudiment, ventral neural tube, roof plate, floor plate, dorsal aorta, sympathetic chain ganglia, endolymphatic duct, otic vesicle epithelium and vascular wall. {ECO:0000269|PubMed:17693064}.
Protein families：