ODFP4_MOUSE Q8VI88
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VI88
Recommended name：Outer dense fiber protein 4
EC number：
Alternative names：(Outer dense fiber of sperm tails protein 4) (Testis-specific protein oppo 1)
Cleaved into：
GeneID：252868
Gene names (primary )：Odf4
Gene names (synonym )：Oppo1
Gene names (ORF )：
Length：290
Mass：33177
Sequence：MEPDLNEEESERIRTSRNRRSLEHRRNSLLPFQWKATNNSRWMAQVVASEFSLVAFLLLLVMVFSKKWLYPSKSRFHQRYPQNVTKRVYTSIHSMSTGLLYICVSKSCPSSDNGEDNFKMWTIHPVFGVAKISFTLAIGLGFVLTTWLHLPYLPCLQRMPFFGLIGIILSFCEVTLIFLTLLLFPVNLWIYELRKNISVPIGWSYFIGWLVLILYFTCGILCYLNHKNYWSLIMSSTTINTACSSLGPESLVSPSQTPSSQENSQESPKDDQKPSSPDKVVSPPQPDTTG
Tissue specificity：Expressed in testis. {ECO:0000269|PubMed:12079992}.
Induction：
Developmental stage：Expressed from late pachytene stage and expression persists during embryonic development. {ECO:0000269|PubMed:12079992}.
Protein families：