KAT3_MOUSE   Q71RI9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q71RI9

Recommended name:Kynurenine--oxoglutarate transaminase 3

EC number:EC 2.6.1.7

Alternative names:(Cysteine-S-conjugate beta-lyase 2) (Kynurenine aminotransferase 3) (Kynurenine aminotransferase III) (KATIII) (Kynurenine--glyoxylate transaminase) (Kynurenine--oxoglutarate transaminase III)

Cleaved into:

GeneID:229905

Gene names  (primary ):Kyat3

Gene names  (synonym ):Ccbl2 Kat3

Gene names  (ORF ):

Length:455

Mass:51126

Sequence:MLLAQRRLISLGCRSKPIKTIYSSSKVLGLCTSAKMALKFKNAKRIEGLDSNVWVEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSKPHFEKLVRFCFIKKDSTLDAAEEIFRAWNSQKS

Tissue specificity:Widely expressed, with higher expression levels in liver, kidney, heart and neuroendocrine tissues. {ECO:0000269|PubMed:16376499}.

Induction:

Developmental stage:Expressed from postnatal day (PND) 7 and peaks in adult. {ECO:0000269|PubMed:16376499}.

Protein families:Class-I pyridoxal-phosphate-dependent aminotransferase family


   💬 WhatsApp