FRS1L_MOUSE B1AXV0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B1AXV0
Recommended name：DOMON domain-containing protein FRRS1L
EC number：
Alternative names：(Ferric-chelate reductase 1-like protein)
Cleaved into：
GeneID：230235
Gene names (primary )：Frrs1l
Gene names (synonym )：
Gene names (ORF )：
Length：293
Mass：32507
Sequence：MAGQPLRRPAWVPLLLRLLLAGIAACDASPADDSAGPGGRGPRGRARGDAGADEAVPRHDSSYGTFASEFYDLRYLSEEGYPFPTAPPVDPFAKIKVEDCGRTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEVQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLFAWGPAIQGAITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP
Tissue specificity：Expressed in the brain (at protein level) (PubMed:22632720). In embryos expression is evident in the ventral forebrain, but a lower level is seen in the remainder of the embryos. In the adult brain, expressed in the cortex, cerebellum, hippocampus and basal ganglia (PubMed:27236917). {ECO:0000269|PubMed:22632720, ECO:0000269|PubMed:27236917}.
Induction：
Developmental stage：Expressed in 12.5 dpc embryos. {ECO:0000269|PubMed:27236917}.
Protein families：