TRIP4_MOUSE Q9QXN3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QXN3
Recommended name：Activating signal cointegrator 1
EC number：
Alternative names：(ASC-1) (Thyroid receptor-interacting protein 4) (TR-interacting protein 4) (TRIP-4)
Cleaved into：
GeneID：56404
Gene names (primary )：Trip4
Gene names (synonym )：
Gene names (ORF )：
Length：581
Mass：66197
Sequence：MAVAGAAYREPLVHWCTQQLQKTFALDVSEEIIQYVLSIENAEEIREYVTDLLQGNEGKKGQFIEDLITKWQKNDQEFISDSFQQCLRKDEILDGQRSVDQLKRSRRKGRNKQEVPAFPEPDVAVEVKTPLDLAKAQESNNSVKKKTRFVNLYTREGQDKLAVLLPGRHPCDCLGQKHKLINNCLVCGRIVCEQEGSGPCLFCGSLVCTNEEQDILQRDSNKSQKLLKKLMSGAETSGKVDVSTKDLLPHQESRMKSGLEKAIKHKEKLLEFDRTSIRRTQVIDDESDYFASDSNQWLSKVEREMLQKREEELRELRHASRLSKKVTIDFAGRKILEDENPLAEYHSRLDETIQAIASGTLNQSLVTLDRSCEEPLGVLVNPNMYQASPQWVDNTGSTPQKKTSLSAGPRLEPSLHQHQLRIQDQEFQEGFDGGWCLSMHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATGKRPSPQEVSELQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFQEQFPDISQESDSSFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLMKQNKAV
Tissue specificity：Ubiquitously expressed (PubMed:12390891). Expressed in the spinal cord, brain, paraspinal ganglia, thyroid, and submandibular glands (PubMed:26924529). Expressed at low level in all the muscles (at protein level) but with higher expression in axial than in limb muscles (PubMed:27008887). {ECO:0000269|PubMed:12390891, ECO:0000269|PubMed:26924529, ECO:0000269|PubMed:27008887}.
Induction：
Developmental stage：Expressed in 17.5-day-old embryos. {ECO:0000269|PubMed:26924529}.
Protein families：