CAZA3_MOUSE   P70190


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P70190

Recommended name:F-actin-capping protein subunit alpha-3

EC number:

Alternative names:(CapZ alpha-3) (Germ cell-specific protein 3)

Cleaved into:

GeneID:12344

Gene names  (primary ):Capza3

Gene names  (synonym ):Cappa3 Gsg3

Gene names  (ORF ):

Length:299

Mass:34952

Sequence:MSLSVLSRKEKEKVIHRLLVQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYCVPLCIDGNPVLLSHHNVMGDFRFFDYQSKLSFRFDLLQNQLRDIQSHGIIRNETEYLRSVVMCALKLYVNDHYPNGNCNVLRKTVKSKEFLIACIEDHSYDNGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEVSKDLKESLEVVNQAQLALSFARLVEEQENKFQAAVIEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII

Tissue specificity:Exclusively expressed in the testis.

Induction:

Developmental stage:Expressed in 24-day-old and adult testis, but not in 4-, 10- and 16-day-old testis.

Protein families:F-actin-capping protein alpha subunit family


   💬 WhatsApp