INSM2_MOUSE Q9JMC2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JMC2
Recommended name:Insulinoma-associated protein 2
EC number:
Alternative names:(Methylated in liver tumor 1)
Cleaved into:
GeneID:56856
Gene names (primary ):Insm2
Gene names (synonym ):Mlt1
Gene names (ORF ):
Length:493
Mass:52225
Sequence:MPRGFLVKRTKRSGSSYRARPVEPLFPPPGPLAAQSSPEEPGRGLLGSPCLAPPQDDAEWGAGGGDGPGPSPARPAGPELRRAFLERCLRSPVSAESFPSATAFCSAAPAAVTSGEELVPPQVPVSVPIPVPGPAPHGLQRRGKGAPVCASAPAAVRKPKAVRRLSFADEVTTSPVLGLKIKEEEPGAPARALGGVRTPLGEFICQLCKHQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACAASKPPHAPLTPPDPSLATGKENGRVPRTDDQHPQAPDSSGDGQHRDSAARPGLQALVYPEAARPQAPYPEVILGRHGPGSSGASAGATSEVFVCPYCHKKFRRQAYLRKHLGTHETGSARAPTPGFGSERTAPLTFACPLCGAHFPSADIREKHRLWHAVREELLLPALVGAPSEAGPGGASDGSAQQIFSCKYCPSTFFSSPGLTRHINKCHPSESRQVLLLQMPLRPGC
Tissue specificity:Expressed in spleen, stomach, liver, kidney and testis. In the pancreas, expressed in islet cells, including insulin-producing beta-cells, but not in acinar cells (at protein level). In the brain, expressed in the neuronal cells of the cerebral cortex, the Purkinje cells of the cerebellum and the hippocampal region including CA1 and CA3 (at protein level). {ECO:0000269|PubMed:11221845, ECO:0000269|PubMed:21343251}.
Induction:Up-regulated by NEUROG3 and NEUROD1. {ECO:0000269|PubMed:21343251}.
Developmental stage:Expressed in 6.5 to 18.5 dpc embryos and transiently up-regulated from 11.5 to 13.5 dpc. In the developing brain, up-regulated 2 weeks postnatally, with gradual decrease thereafter. Still detectable at 52 weeks. {ECO:0000269|PubMed:21343251}.
Protein families: