NEPRO_MOUSE Q8R2U2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R2U2
Recommended name：Nucleolus and neural progenitor protein
EC number：
Alternative names：(Neural progenitor protein)
Cleaved into：
GeneID：212547
Gene names (primary )：Nepro
Gene names (synonym )：
Gene names (ORF )：
Length：564
Mass：63394
Sequence：MAAAVRPGAEPWNRVRIPQAGNCSTLTVRDPSATLDICTAAVTKGCHLVTQSLKSQTLDAEVDVLCSVLYSNHNRLGHHKPHLALRQVEQCLKRLKHMNLEGSIEDLSQLLSANATQPGATENRVVPSQPVVEVVLMKVLGGCKLLLRLLDCCCKAFLLTVKHLGLKEFIILNLVMVGLVSRLWVLHKGLLRRLISLYEPLLSLRQEISSIHPMPYFKDFAFPSDITDFLGPSYLEVFKVKTPAASATKGVTKLLNKLFLMREQLPKMNEDTLDRLSKPSEQMTSNPQSTVDLGQPVKACKRTRKEKPLGFDLRAFCTRLGNKATQETNRDFKYSQSKLKTTKLPSQQLRTHWANDTVQRIRKTKTFAQLSEEIEMAIVWSRSKKLKTQATFLGNKLLKSNRFRHVESQGYSLTKKLQCMKTSLCNCLLRGSRTSTSEHPPRQRRSKYKVLSRQRKPQRKLQSTLLKETQQVPEGTLKNTRDSSAKRRCSGTVQRSDVCPNGKQVLRKLAKPDLKTKVVVHGNLTGGSRNESGFQAKTQMHTHNAPDTAKEADDIDDIFALMGV
Tissue specificity：
Induction：
Developmental stage：Expressed in all blastomeres at the 8-cell stage (PubMed:26178919). Detected in the ventricular zone (VZ) of the forebrain at 9.5 dpc. Clearly detected until 12.5 dpc, the expression decreases and disappears by 15.5 dpc (PubMed:19906856). {ECO:0000269|PubMed:19906856, ECO:0000269|PubMed:26178919}.
Protein families：Nepro family